PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN19264.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 364aa    MW: 40902.2 Da    PI: 6.241
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN19264.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding521.6e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l ++++++G g+W+++++  g+ R++k+c++rw +yl
       KHN19264.1 14 KGLWSPEEDEKLFNYITRFGVGCWSSVPKQAGLQRCGKSCRLRWINYL 61
                     678*******************************************97 PP

2Myb_DNA-binding46.39.7e-1567110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg ++++E++l++ +++ lG++ W+ Ia+ ++ gRt++++k++w++
       KHN19264.1  67 RGMFSQQEEDLIISLHEVLGNR-WAQIAAQLP-GRTDNEIKNFWNS 110
                      788*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.3E-26664IPR009057Homeodomain-like
PROSITE profilePS5129417.994961IPR017930Myb domain
SuperFamilySSF466896.74E-2912108IPR009057Homeodomain-like
SMARTSM007174.2E-121363IPR001005SANT/Myb domain
PfamPF002492.3E-141461IPR001005SANT/Myb domain
CDDcd001678.19E-111761No hitNo description
PROSITE profilePS5129424.35362116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.8E-2565116IPR009057Homeodomain-like
SMARTSM007172.4E-1366114IPR001005SANT/Myb domain
PfamPF002499.1E-1467111IPR001005SANT/Myb domain
CDDcd001674.07E-1070109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 364 aa     Download sequence    Send to blast
MGRHSCCLKQ KLRKGLWSPE EDEKLFNYIT RFGVGCWSSV PKQAGLQRCG KSCRLRWINY  60
LRPDLKRGMF SQQEEDLIIS LHEVLGNRWA QIAAQLPGRT DNEIKNFWNS CLKKKLMKQG  120
IDPATHKPLL GAEEHIIIKV EKETILETPP NPILLQVSQG ILVSSNESPL VVNNSSYYDG  180
GLNVTEEASR DVFMSKNAAL DYPLSYFEFQ MGYNPIRQFD QNHIVGTNSS YGFSSLPCLN  240
SSSDHGNMLV EAEFSDNNSA SKISALMKES SSNSPSMSVY PAGGGCQMME NAGFSWDGEN  300
HNNNTKIDPL LQFHVNVVKS KEFKTSSWQE GQILTQNSID FTSYPLMSLS EDLTGANFDV  360
FQHM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-29121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0956760.0BT095676.1 Soybean clone JCVI-FLGm-19P23 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003527003.10.0PREDICTED: transcription factor MYB86-like
TrEMBLA0A0B2QGF60.0A0A0B2QGF6_GLYSO; Transcription factor MYB86
STRINGGLYMA06G18830.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF58313353
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.12e-82myb domain protein 86
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]